Information & Communication Technology

IFS is a multinational software company currently valued at EUR20 billion with worldwide operations including a significant presence in the U.S. IFS develops and delivers enterprise software for companies around the world who manufacture and distribute goods, build and maintain assets, and manage service-focused operations.

Agriculture

Thecompanyistheleadinganimalhealthcompanyinthe Middle Eastand Africaintermsofhead count aswellas annualturnoverpartneringwithenormousmultinationalsinitsindustryandoffering top-tiersolutionstoitscustomers.Thecompanyhas 14 affiliatescoveringdifferentmarketsegments andspecies.

Established in 1973, IGI is the parent to a large family of diversified companies with activities including petroleum, industrial services, trade in various commodities and consumer goods, landscaping and

Petroleum

IPIR Energy Group constitutes a synergy of specialized oil and gas operating companies with extensive field services including technology transfer. The Group has experienced employees including geophysicists, geologists, engineers, certified public accountants, systems analysts and financial controllers.

Information & Communication Technology

Incorta's enterprise analytics platform aggregates complex business data in real time, reducing from months to days the time required to rollout new analytics applications, and reduces reporting times from hours to seconds. Companies such as Broadcom, Shutterfly, Keysight, Stitch Fix, Guittard and Facebook are recognizing the value of this disruptive change and are helping to lead the charge.

Financial Sector

Established in 1947, the Industrial Development Bank provides a distinct set of banking products and services with a specialized vision in all economic and development activities. The bank focuses on financing local industries across a variety of sectors, with the goal of substituting imports and promoting Egyptian exports.

Real Estate

Established in 2008, Industrial Development Group (IDG) owns, develops and manages industrial parks for local and multinational enterprises. IDG's portfolio currently comprises three integrated industrial parks covering a collective area of 22 km and strategically positioned near key city centers with easy access to maritime ports, airports and major roads.

Building Materials

An Egyptian company that acts as anagentand distributor forleading brandnames, as well as a trustedsuplirveralctrsinheytianmarketnludingcmentstelodaper automotive.Thecompany is committed to efficiently deliveringhigh-qualityproductstocustomers andensuringlifetimetrouble-freeperformancewiththeaimofreducingproductioncosts.

Agriculture

CENTECHisajoint-stockventurecompanyinvolvedinagro-engineeringandcommercial activities includingfertilizerandpesticides.Itistheownerof Sahara Company, afullpackingcomplexwith pre-coolingandcoldstoragefacilitiesforfruitsandvegetables.

Pharmaceuticals

IEC is a reputable company in the medical business in Egypt and the sole distributor for Varian Medical Systems and Philips Medical Systems.

Marketing, Advertising Services

As a full-service professional marketing team, INEXT provides digital marketing techniques to assist its customers in promoting their products. INEXT provides opportunities for projects with creative and different ideas by helping them bring their ideas to life.

Information & Communication Technology

Infoblox is a privately held IT automation and security company based in California's Silicon Valley. Domain Name Service (DNS), DHCP and IP management.

Consultancy

Informa Markets creates platforms for industries and specialist markets to trade, innovate and grow. The company has more than 550 international B2B events and brands in markets including healthcare and pharmaceuticals, infrastructure, construction and real estate, fashion and apparel, hospitality food and beverage, and health and nutrition, among others.

Information & Communication Technology

ITSC is a software development house that operates local and international money transfer platforms exceeding 100, 000 transactions per day. ITSC is a partner of Money Gram and other money transfer operators and exchange houses from all over the world.

Public & Governmental Organizations

A governmental entity established through Law 15/2004 that aims to promote the spread of e-business services in Egypt, capitalizing on the Egyptian e-signature law and supporting an export-oriented IT sector.

Information & Communication Technology

ITECorp offers its enterprise customers a wide range of IT-related software and services including Microsoft Enterprise Agreements, MPSA, Autodesk products, business consulting, software asset management, licensing and infrastructure services with special emphasis on network security.

Construction Engineering Services

Innovo Group is a leader in urban development specialized in the design, engineering, and construction of city projects across four continents. Building on 35 years experience, the company's portfolio reflects a broad range of projects including high rise towers, residential developments, villa communities, educational facilities, commercial hubs, and urban infrastructure.

Insurance

IFE is a non-profit organization that has operated in Egypt since 1953, and membership is mandatory for all insurance companies working in Egypt (42 life and non-life insurance companies). IFE provides sustainable inclusive insurance, sets the main strategies of the sector raises insurance awareness, and represents its members locally and internationally.

Building Materials

Since 1987, Insutech has been the leading manufacturer of thermal insulation, waterproofing, and exterior decoration products for a variety of industries. The company's products are trusted all around the world, providing stress-free and cost-effective engineering solutions to more than 90 countries.

Petroleum

catalyst, adsorbent and process plant for the refining, petrochemicals and gas processing industries.

Pharmaceuticals

IDH is a leading diagnostics company in Egypt, Jordan, Sudan and Nigeria, with around 550 branches serving over 10 million patients per year. Brands include Al Borg, Al Borg Scan, and Al Mokhtabar in Egypt; Biolab (Jordan); Ultralab and Al Mokhtabar (Sudan); and Echo-Lab (Nigeria). IDH is listed on the London and Egypt stock exchanges.

Security Systems (Alarms, Firefighting, Video Cameras, etc.)

IFSS Group, established in 2016, is a security system integrator specialized in fire detection, access control, CCTV, and intrusion detection systems.

Service Providers

Hospitality/Tourism/Travel

Cairo's leading business hotel, the luxurious and contemporary Inter Continental blend of sophistication and comfort. With a prime location adjacent to Citystars Heliopolis, one of Cairo's largest shopping and entertainment destinations, guests can enjoy convenient access to retail therapy, dining, and cultural attractions.